Lineage for d1gs0b2 (1gs0 B:341-557)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234080Family d.166.1.2: Poly(ADP-ribose) polymerase, C-terminal domain [56416] (2 proteins)
    automatically mapped to Pfam PF00644
  6. 2234081Protein Poly(ADP-ribose) polymerase, C-terminal domain [56417] (3 species)
  7. 2234101Species Mouse (Mus musculus) [TaxId:10090] [82817] (1 PDB entry)
  8. 2234103Domain d1gs0b2: 1gs0 B:341-557 [76326]
    Other proteins in same PDB: d1gs0a1, d1gs0b1

Details for d1gs0b2

PDB Entry: 1gs0 (more details), 2.8 Å

PDB Description: crystal structure of the catalytic fragment of murine poly (adp-ribose) polymerase-2
PDB Compounds: (B:) poly (ADP-ribose) polymerase-2

SCOPe Domain Sequences for d1gs0b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gs0b2 d.166.1.2 (B:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]}
lhcalrpldhesnefkvisqylqsthapthkdytmtlldvfevekegekeafredlpnrm
llwhgsrlsnwvgilshglrvappeapitgymfgkgiyfadmssksanycfasrlkntgl
lllsevalgqcnelleanpkaqgllrgkhstkgmgkmapspahfitlngstvplgpasdt
gilnpegytlnynefivyspnqvrmryllkiqfnflq

SCOPe Domain Coordinates for d1gs0b2:

Click to download the PDB-style file with coordinates for d1gs0b2.
(The format of our PDB-style files is described here.)

Timeline for d1gs0b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gs0b1