SCOPe 2.03: Domain d1gr1a1: 1gr1 A:9-141

Lineage for d1gr1a1 (1gr1 A:9-141)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.43: Reductase/isomerase/elongation factor common domain [50412] (4 superfamilies)
   barrel, closed; n=6, S=10; greek-key

4. Superfamily b.43.4: Riboflavin synthase domain-like [63380] (4 families)

5. Family b.43.4.2: Ferredoxin reductase FAD-binding domain-like [63381] (10 proteins)
   coupled with a NADP-binding domain of alpha/beta class

6. Protein Ferredoxin reductase (flavodoxin reductase) N-terminal domain [50415] (9 species)

7. Species Anabaena sp., pcc 7119 [TaxId:1167] [50420] (24 PDB entries)

8. Domain d1gr1a1: 1gr1 A:9-141 [76319]
   Other proteins in same PDB: d1gr1a2
   complexed with fad, so4

Details for d1gr1a1

PDB Entry: 1gr1, 2.5 Å

PDB Description: structure of ferredoxin-nadp+ reductase with glu 139 replaced by lys (e139k)

PDB Compounds: (A:) ferredoxin--nadp+ reductase

SCOPe Domain Sequences for d1gr1a1:

Sequence; same for both SEQRES and ATOM records:

>d1gr1a1 b.43.4.2 (A:9-141) Ferredoxin reductase (flavodoxin reductase) N-terminal domain {Anabaena sp., pcc 7119 [TaxId: 1167]}
dvpvnlyrpnapfigkvisneplvkeggigivqhikfdltggnlkyiegqsigiippgvd
kngkpeklrlysiastrhgddvddktislcvrqleykhpesgetvygvcstylthiepgs
evkitgpvgkkml

Timeline for d1gr1a1:

• d1gr1a1 first appeared in SCOP 1.63
  
• d1gr1a1 appears in SCOPe 2.02
  
• d1gr1a1 appears in SCOPe 2.04
  
• d1gr1a1 appears in the current release, SCOPe 2.08