Lineage for d1gqib2 (1gqi B:5-151)

  1. Root: SCOP 1.63
  2. 251695Class d: Alpha and beta proteins (a+b) [53931] (224 folds)
  3. 259924Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 260262Superfamily d.92.2: beta-N-acetylhexosaminidase-like domain [55545] (2 families) (S)
    contains similar fold but lacks its catalytic centre
  5. 260278Family d.92.2.2: alpha-D-glucuronidase, N-terminal domain [82737] (1 protein)
    family GH67
  6. 260279Protein alpha-D-glucuronidase, N-terminal domain [82738] (2 species)
  7. 260284Species Pseudomonas cellulosa [TaxId:155077] [82739] (4 PDB entries)
  8. 260286Domain d1gqib2: 1gqi B:5-151 [76282]
    Other proteins in same PDB: d1gqia1, d1gqib1
    complexed with co, edo, mg

Details for d1gqib2

PDB Entry: 1gqi (more details), 1.48 Å

PDB Description: structure of pseudomonas cellulosa alpha-d-glucuronidase

SCOP Domain Sequences for d1gqib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gqib2 d.92.2.2 (B:5-151) alpha-D-glucuronidase, N-terminal domain {Pseudomonas cellulosa}
edgydmwlryqpiadqtllktyqkqirhlhvagdsptinaaaaelqrglsgllnkpivar
deklkdyslvigtpdnspliaslnlgerlqalgaegylleqtrinkrhvvivaansdvgv
lygsfhllrliqtqhaleklslssapr

SCOP Domain Coordinates for d1gqib2:

Click to download the PDB-style file with coordinates for d1gqib2.
(The format of our PDB-style files is described here.)

Timeline for d1gqib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gqib1