SCOPe 2.06: Domain d1go8p2: 1go8 P:20-258

Lineage for d1go8p2 (1go8 P:20-258)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
   characteristic HEXXHXXGXXH motif and Met located near C-terminus

6. Protein Metalloprotease [55509] (4 species)
   the rest of protein is all-beta sandwich containing a parallel beta-helix

7. Species Erwinia chrysanthemi [TaxId:556] [82735] (9 PDB entries)
   Protease C

8. Domain d1go8p2: 1go8 P:20-258 [76248]
   Other proteins in same PDB: d1go8p1
   complexed with ca, po4, zn; mutant

Details for d1go8p2

PDB Entry: 1go8, 2 Å

PDB Description: the metzincin's methionine: prtc m226l mutant

PDB Compounds: (P:) protease c

SCOPe Domain Sequences for d1go8p2:

Sequence; same for both SEQRES and ATOM records:

>d1go8p2 d.92.1.6 (P:20-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
tssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfk
flqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrd
asgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahp
geynagegdpsyndavyaedsyqfsilsywgenetgadynghyggapmiddiaaiqrly

Timeline for d1go8p2:

• d1go8p2 first appeared in SCOP 1.63
  
• d1go8p2 appears in SCOPe 2.05
  
• d1go8p2 appears in SCOPe 2.07
  
• d1go8p2 appears in the current release, SCOPe 2.08