Lineage for d1go8p2 (1go8 P:20-258)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1423492Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1423493Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1423746Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 1423747Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 1423748Species Erwinia chrysanthemi [TaxId:556] [82735] (7 PDB entries)
    Protease C
  8. 1423753Domain d1go8p2: 1go8 P:20-258 [76248]
    Other proteins in same PDB: d1go8p1
    complexed with ca, po4, zn; mutant

Details for d1go8p2

PDB Entry: 1go8 (more details), 2 Å

PDB Description: the metzincin's methionine: prtc m226l mutant
PDB Compounds: (P:) protease c

SCOPe Domain Sequences for d1go8p2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1go8p2 d.92.1.6 (P:20-258) Metalloprotease {Erwinia chrysanthemi [TaxId: 556]}
tssaynsvydflryhdrgdgltvngktsysidqaaaqitrenvswngtnvfgksanltfk
flqsvssipsgdtgfvkfnaeqieqaklslqswsdvanltftevtgnksanitfgnytrd
asgnldygtqayayypgnyqgagsswynynqsnirnpgseeygrqtftheighalglahp
geynagegdpsyndavyaedsyqfsilsywgenetgadynghyggapmiddiaaiqrly

SCOPe Domain Coordinates for d1go8p2:

Click to download the PDB-style file with coordinates for d1go8p2.
(The format of our PDB-style files is described here.)

Timeline for d1go8p2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1go8p1