SCOP 1.63: Domain d1go8p1: 1go8 P:259-479

Lineage for d1go8p1 (1go8 P:259-479)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.79: beta-Roll [51119] (1 superfamily)
   contains a parallel beta-helix that binds calcium ions between its turns

4. Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family)
   duplication: halfturs of beta-helix are sequence and structural repeats

5. Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)

6. Protein Metalloprotease [51122] (4 species)
   The catalitic N-terminal domain belong to the "zincin" superfamily

7. Species Erwinia chrysanthemi [TaxId:556] [82189] (5 PDB entries)
   protease C

8. Domain d1go8p1: 1go8 P:259-479 [76247]
   Other proteins in same PDB: d1go8p2
   complexed with ca, po4, zn; mutant

Details for d1go8p1

PDB Entry: 1go8, 2 Å

PDB Description: the metzincin's methionine: prtc m226l mutant

SCOP Domain Sequences for d1go8p1:

Sequence; same for both SEQRES and ATOM records:

>d1go8p1 b.79.1.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi}
ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln
egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt
lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe
vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv

Timeline for d1go8p1:

• d1go8p1 is new in SCOP 1.63
  
• d1go8p1 appears in SCOP 1.65
  
• d1go8p1 appears in the current release, SCOPe 2.08