![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.79: beta-Roll [51119] (1 superfamily) contains a parallel beta-helix that binds calcium ions between its turns |
![]() | Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) ![]() duplication: halfturs of beta-helix are sequence and structural repeats |
![]() | Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) |
![]() | Protein Metalloprotease [51122] (4 species) The catalitic N-terminal domain belong to the "zincin" superfamily |
![]() | Species Erwinia chrysanthemi [TaxId:556] [82189] (5 PDB entries) protease C |
![]() | Domain d1go7p1: 1go7 P:259-479 [76245] Other proteins in same PDB: d1go7p2 complexed with ca, po4, zn; mutant |
PDB Entry: 1go7 (more details), 2.1 Å
SCOP Domain Sequences for d1go7p1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1go7p1 b.79.1.1 (P:259-479) Metalloprotease {Erwinia chrysanthemi} ganmttrtgdsvygfnsntdrdfytatdsskalifsvwdaggtdtfdfsgysnnqrinln egsfsdvgglkgnvsiahgvtienaiggsgndilvgnsadnilqggagndvlyggagadt lyggagrdtfvygsgqdstvaaydwiadfqkgidkidlsafrnegqlsfvqdqftgkgqe vmlqwdaansitnlwlheaghssvdflvrivgqaaqsdiiv
Timeline for d1go7p1: