Class d: Alpha and beta proteins (a+b) [53931] (224 folds) |
Fold d.92: Zincin-like [55485] (2 superfamilies) contains mixed beta sheet with connection over free side of the sheet |
Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) |
Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein) characteristic HEXXHXXGXXH motif and Met located near C-terminus |
Protein Metalloprotease [55509] (4 species) the rest of protein is all-beta sandwich containing a parallel beta-helix |
Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (2 PDB entries) psychrophilic alkaline protease |
Domain d1g9ka2: 1g9k A:3-244 [76218] Other proteins in same PDB: d1g9ka1 complexed with ca, so4, zn |
PDB Entry: 1g9k (more details), 1.96 Å
SCOP Domain Sequences for d1g9ka2:
Sequence, based on SEQRES records: (download)
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl yg
>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18} gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaarddghmtfanfs asnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgdy nptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg
Timeline for d1g9ka2: