Lineage for d1g9ka2 (1g9k A:3-244)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2963580Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 2963581Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. 2963971Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (2 proteins)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 2963972Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 2963987Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries)
    psychrophilic alkaline protease
  8. 2963988Domain d1g9ka2: 1g9k A:3-244 [76218]
    Other proteins in same PDB: d1g9ka1
    complexed with ca, so4, zn

Details for d1g9ka2

PDB Entry: 1g9k (more details), 1.96 Å

PDB Description: crystal structure of a psychrophilic alkaline protease from pseudomonas tac ii 18
PDB Compounds: (A:) serralysin

SCOPe Domain Sequences for d1g9ka2:

Sequence, based on SEQRES records: (download)

>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records): (download)

>d1g9ka2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18 [TaxId: 306]}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaarddghmtfanfs
asnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgdy
nptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

SCOPe Domain Coordinates for d1g9ka2:

Click to download the PDB-style file with coordinates for d1g9ka2.
(The format of our PDB-style files is described here.)

Timeline for d1g9ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g9ka1