![]() | Class b: All beta proteins [48724] (119 folds) |
![]() | Fold b.79: beta-Roll [51119] (1 superfamily) contains a parallel beta-helix that binds calcium ions between its turns |
![]() | Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) ![]() duplication: halfturs of beta-helix are sequence and structural repeats |
![]() | Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein) |
![]() | Protein Metalloprotease [51122] (4 species) The catalitic N-terminal domain belong to the "zincin" superfamily |
![]() | Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (2 PDB entries) psychrophilic alkaline protease |
![]() | Domain d1g9ka1: 1g9k A:245-463 [76217] Other proteins in same PDB: d1g9ka2 complexed with ca, so4, zn |
PDB Entry: 1g9k (more details), 1.96 Å
SCOP Domain Sequences for d1g9ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ka1 b.79.1.1 (A:245-463) Metalloprotease {Pseudomonas sp., tac ii 18} anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva
Timeline for d1g9ka1: