Lineage for d1g9ka1 (1g9k A:245-463)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 234260Fold b.79: beta-Roll [51119] (1 superfamily)
    contains a parallel beta-helix that binds calcium ions between its turns
  4. 234261Superfamily b.79.1: Serralysin-like metalloprotease, C-terminal domain [51120] (1 family) (S)
    duplication: halfturs of beta-helix are sequence and structural repeats
  5. 234262Family b.79.1.1: Serralysin-like metalloprotease, C-terminal domain [51121] (1 protein)
  6. 234263Protein Metalloprotease [51122] (4 species)
    The catalitic N-terminal domain belong to the "zincin" superfamily
  7. 234274Species Pseudomonas sp., tac ii 18 [TaxId:306] [82190] (2 PDB entries)
    psychrophilic alkaline protease
  8. 234275Domain d1g9ka1: 1g9k A:245-463 [76217]
    Other proteins in same PDB: d1g9ka2
    complexed with ca, so4, zn

Details for d1g9ka1

PDB Entry: 1g9k (more details), 1.96 Å

PDB Description: crystal structure of a psychrophilic alkaline protease from pseudomonas tac ii 18

SCOP Domain Sequences for d1g9ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ka1 b.79.1.1 (A:245-463) Metalloprotease {Pseudomonas sp., tac ii 18}
anletraddtvygfnstadrdfysatsstdklifsvwdgggndtldfsgfsqnqkinlta
gsfsdvggmtgnvsiaqgvtienaiggsgndlligndaanvlkggagndiiyggggadvl
wggtgsdtfvfgavsdstpkaadiikdfqsgfdkidltaitklgglnfvdaftghagdai
vsyhqasnagslqvdfsgqgvadflvttvgqvatydiva

SCOP Domain Coordinates for d1g9ka1:

Click to download the PDB-style file with coordinates for d1g9ka1.
(The format of our PDB-style files is described here.)

Timeline for d1g9ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1g9ka2