Class b: All beta proteins [48724] (144 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins) |
Protein Camelid IG heavy chain variable domain, VHh [88563] (2 species) |
Species Llama (Lama glama) [TaxId:9844] [88565] (7 PDB entries) |
Domain d1g9ea_: 1g9e A: [76216] anti-gonadotropin alpha subunit VHh domain |
PDB Entry: 1g9e (more details)
SCOP Domain Sequences for d1g9ea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ea_ b.1.1.1 (A:) Camelid IG heavy chain variable domain, VHh {Llama (Lama glama)} qvqlqesggglvqaggslrlscaasgrtgstydmgwfrqapgkeresvaainwdsartyy assvrgrftisrdnakktvylqmnslkpedtavytcgageggtwdswgqgtqvtvss
Timeline for d1g9ea_: