Class b: All beta proteins [48724] (178 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.4: STI-like [50386] (3 families) |
Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (3 proteins) overall fold is very similar to that of the STI family automatically mapped to Pfam PF07951 |
Protein Botulinum neurotoxin [50402] (2 species) |
Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (14 PDB entries) |
Domain d1g9ba2: 1g9b A:1080-1290 [76205] Other proteins in same PDB: d1g9ba1, d1g9ba3, d1g9ba4 complexed with bab, zn |
PDB Entry: 1g9b (more details), 2 Å
SCOPe Domain Sequences for d1g9ba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1g9ba2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]} seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis kwylkevkrkpynlklgcnwqfipkdegwte
Timeline for d1g9ba2: