Lineage for d1g9ba2 (1g9b A:1080-1290)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 800749Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 801105Superfamily b.42.4: STI-like [50386] (2 families) (S)
  5. 801140Family b.42.4.2: Clostridium neurotoxins, C-terminal domain [50399] (2 proteins)
    overall fold is very similar to that of the STI family
  6. 801141Protein Botulinum neurotoxin [50402] (2 species)
  7. 801144Species Clostridium botulinum, serotype B [TaxId:1491] [50404] (16 PDB entries)
  8. 801148Domain d1g9ba2: 1g9b A:1080-1290 [76205]
    Other proteins in same PDB: d1g9ba1, d1g9ba3, d1g9ba4
    complexed with bab, zn

Details for d1g9ba2

PDB Entry: 1g9b (more details), 2 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 1)
PDB Compounds: (A:) botulinum neurotoxin type b

SCOP Domain Sequences for d1g9ba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g9ba2 b.42.4.2 (A:1080-1290) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
seylkdfwgnplmynkeyymfnagnknsyiklkkdspvgeiltrskynqnskyinyrdly
igekfiirrksnsqsinddivrkedyiyldffnlnqewrvytykyfkkeeeklflapisd
sdefyntiqikeydeqptyscqllfkkdeestdeigligihrfyesgivfeeykdyfcis
kwylkevkrkpynlklgcnwqfipkdegwte

SCOP Domain Coordinates for d1g9ba2:

Click to download the PDB-style file with coordinates for d1g9ba2.
(The format of our PDB-style files is described here.)

Timeline for d1g9ba2: