SCOP 1.75: Domain d1g9aa1: 1g9a A:862-1079

Lineage for d1g9aa1 (1g9a A:862-1079)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (25 families)

5. Family b.29.1.6: Clostridium neurotoxins, the second last domain [49956] (2 proteins)

6. Protein Botulinum neurotoxin [49959] (2 species)

7. Species Clostridium botulinum, serotype B [TaxId:1491] [49961] (16 PDB entries)

8. Domain d1g9aa1: 1g9a A:862-1079 [76200]
   Other proteins in same PDB: d1g9aa2, d1g9aa3, d1g9aa4
   complexed with bab, zn

Details for d1g9aa1

PDB Entry: 1g9a, 2.1 Å

PDB Description: crystal structure of clostridium botulinum neurotoxin b complexed with an inhibitor (experiment 3)

PDB Compounds: (A:) botulinum neurotoxin type b

SCOP Domain Sequences for d1g9aa1:

Sequence; same for both SEQRES and ATOM records:

>d1g9aa1 b.29.1.6 (A:862-1079) Botulinum neurotoxin {Clostridium botulinum, serotype B [TaxId: 1491]}
niilnlrykdnnlidlsgygakvevydgvelndknqfkltssanskirvtqnqniifnsv
fldfsvsfwiripkykndgiqnyihneytiincmknnsgwkisirgnriiwtlidingkt
ksvffeynirediseyinrwffvtitnnlnnakiyingklesntdikdireviangeiif
kldgdidrtqfiwmkyfsifntelsqsnieerykiqsy

Timeline for d1g9aa1:

• d1g9aa1 first appeared in SCOP 1.63
  
• d1g9aa1 appears in SCOP 1.73
  
• d1g9aa1 appears in SCOPe 2.01
  
• d1g9aa1 appears in the current release, SCOPe 2.08