Class d: Alpha and beta proteins (a+b) [53931] (286 folds) |
Fold d.129: TBP-like [55944] (9 superfamilies) beta-alpha-beta(4)-alpha |
Superfamily d.129.3: Bet v1-like [55961] (6 families) contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins) |
Protein Major tree pollen allergen [55963] (4 species) |
Species European white birch (Betula pendula), Bet v 1-l [TaxId:3505] [82782] (1 PDB entry) |
Domain d1fm4a_: 1fm4 A: [76186] complexed with dho |
PDB Entry: 1fm4 (more details), 1.97 Å
SCOP Domain Sequences for d1fm4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l} gvfnyeteatsvipaarmfkafildgdklvpkvapqaissveniegnggpgtikkinfpe gfpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnky htkgnhevkaeqvkaskemgetllravesyllahsdayn
Timeline for d1fm4a_: