Lineage for d1fm4a_ (1fm4 A:)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 610723Fold d.129: TBP-like [55944] (9 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 610890Superfamily d.129.3: Bet v1-like [55961] (6 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 610891Family d.129.3.1: Pathogenesis-related protein 10 (PR10)-like [55962] (3 proteins)
  6. 610896Protein Major tree pollen allergen [55963] (4 species)
  7. 610897Species European white birch (Betula pendula), Bet v 1-l [TaxId:3505] [82782] (1 PDB entry)
  8. 610898Domain d1fm4a_: 1fm4 A: [76186]
    complexed with dho

Details for d1fm4a_

PDB Entry: 1fm4 (more details), 1.97 Å

PDB Description: crystal structure of the birch pollen allergen bet v 1l

SCOP Domain Sequences for d1fm4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fm4a_ d.129.3.1 (A:) Major tree pollen allergen {European white birch (Betula pendula), Bet v 1-l}
gvfnyeteatsvipaarmfkafildgdklvpkvapqaissveniegnggpgtikkinfpe
gfpfkyvkdrvdevdhtnfkynysvieggpvgdtlekisneikivatpdggcvlkisnky
htkgnhevkaeqvkaskemgetllravesyllahsdayn

SCOP Domain Coordinates for d1fm4a_:

Click to download the PDB-style file with coordinates for d1fm4a_.
(The format of our PDB-style files is described here.)

Timeline for d1fm4a_: