Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (28 PDB entries) |
Domain d1ffpd2: 1ffp D:2-181 [76181] Other proteins in same PDB: d1ffpa1, d1ffpb1, d1ffpb2, d1ffpd1, d1ffpe1, d1ffpe2 |
PDB Entry: 1ffp (more details), 2.6 Å
SCOPe Domain Sequences for d1ffpd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffpd2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d1ffpd2: