Lineage for d1ffpd1 (1ffp D:182-274)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 654537Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 654719Species Mouse (Mus musculus) [TaxId:10090] [88606] (78 PDB entries)
  8. 654804Domain d1ffpd1: 1ffp D:182-274 [76180]
    Other proteins in same PDB: d1ffpa2, d1ffpb_, d1ffpd2, d1ffpe_
    mutant

Details for d1ffpd1

PDB Entry: 1ffp (more details), 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)
PDB Compounds: (D:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOP Domain Sequences for d1ffpd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffpd1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

SCOP Domain Coordinates for d1ffpd1:

Click to download the PDB-style file with coordinates for d1ffpd1.
(The format of our PDB-style files is described here.)

Timeline for d1ffpd1: