Class b: All beta proteins [48724] (126 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
Protein Class I MHC, alpha-3 domain [88604] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88606] (49 PDB entries) |
Domain d1ffpd1: 1ffp D:182-274 [76180] Other proteins in same PDB: d1ffpa2, d1ffpb_, d1ffpd2, d1ffpe_ mutant |
PDB Entry: 1ffp (more details), 2.6 Å
SCOP Domain Sequences for d1ffpd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffpd1 b.1.1.2 (D:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus)} tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf qkwasvvvplgkeqnytcrvyheglpepltlrw
Timeline for d1ffpd1:
View in 3D Domains from other chains: (mouse over for more information) d1ffpa1, d1ffpa2, d1ffpb_, d1ffpe_ |