SCOPe 2.06: Domain d1ffpa2: 1ffp A:2-181

Lineage for d1ffpa2 (1ffp A:2-181)

Root: SCOPe 2.06
Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
dimeric
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (27 PDB entries)
Domain d1ffpa2: 1ffp A:2-181 [76178]
Other proteins in same PDB: d1ffpa1, d1ffpb1, d1ffpb2, d1ffpd1, d1ffpe1, d1ffpe2

Details for d1ffpa2

PDB Entry: 1ffp (more details), 2.6 Å

PDB Description: crystal structure of murine class i h-2db complexed with peptide gp33 (c9m/k1s)

PDB Compounds: (A:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffpa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffpa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1ffpa2:

Click to download the PDB-style file with coordinates for d1ffpa2.
(The format of our PDB-style files is described here.)

Timeline for d1ffpa2: