Class d: Alpha and beta proteins (a+b) [53931] (279 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (1 family) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (12 proteins) |
Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (21 species) |
Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (18 PDB entries) |
Domain d1ffpa2: 1ffp A:2-181 [76178] Other proteins in same PDB: d1ffpa1, d1ffpb_, d1ffpd1, d1ffpe_ |
PDB Entry: 1ffp (more details), 2.6 Å
SCOP Domain Sequences for d1ffpa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ffpa2 d.19.1.1 (A:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB} phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr
Timeline for d1ffpa2:
View in 3D Domains from other chains: (mouse over for more information) d1ffpb_, d1ffpd1, d1ffpd2, d1ffpe_ |