SCOPe 2.02: Domain d1ffoe_: 1ffo E:

Lineage for d1ffoe_ (1ffo E:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (5 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (150 PDB entries)
   Uniprot P01887

8. Domain d1ffoe_: 1ffo E: [76176]
   Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2

Details for d1ffoe_

PDB Entry: 1ffo, 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)

PDB Compounds: (E:) beta-2 microglobulin beta chain

SCOPe Domain Sequences for d1ffoe_:

Sequence; same for both SEQRES and ATOM records:

>d1ffoe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1ffoe_:

• d1ffoe_ first appeared in SCOP 1.63
  
• d1ffoe_ appears in SCOPe 2.01
  
• d1ffoe_ appears in SCOPe 2.03
  
• d1ffoe_ appears in the current release, SCOPe 2.08, called d1ffoe1