Lineage for d1ffoe_ (1ffo E:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 548300Protein beta2-microglobulin [88600] (4 species)
  7. 548438Species Mouse (Mus musculus) [TaxId:10090] [88603] (66 PDB entries)
  8. 548507Domain d1ffoe_: 1ffo E: [76176]
    Other proteins in same PDB: d1ffoa1, d1ffoa2, d1ffod1, d1ffod2
    mutant

Details for d1ffoe_

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)

SCOP Domain Sequences for d1ffoe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffoe_ b.1.1.2 (E:) beta2-microglobulin {Mouse (Mus musculus)}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1ffoe_:

Click to download the PDB-style file with coordinates for d1ffoe_.
(The format of our PDB-style files is described here.)

Timeline for d1ffoe_: