Lineage for d1ffod2 (1ffo D:2-181)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2937656Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. 2938003Species Mouse (Mus musculus), H-2DB [TaxId:10090] [54482] (29 PDB entries)
  8. 2938055Domain d1ffod2: 1ffo D:2-181 [76175]
    Other proteins in same PDB: d1ffoa1, d1ffob1, d1ffob2, d1ffod1, d1ffoe1, d1ffoe2

Details for d1ffod2

PDB Entry: 1ffo (more details), 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)
PDB Compounds: (D:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOPe Domain Sequences for d1ffod2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ffod2 d.19.1.1 (D:2-181) Class I MHC, alpha-1 and alpha-2 domains {Mouse (Mus musculus), H-2DB [TaxId: 10090]}
phsmryfetavsrpgleepryisvgyvdnkefvrfdsdaenpryeprapwmeqegpeywe
retqkakgqeqwfrvslrnllgyynqsaggshtlqqmsgcdlgsdwrllrgylqfayegr
dyialnedlktwtaadmaaqitrrkweqsgaaehykaylegecvewlhrylkngnatllr

SCOPe Domain Coordinates for d1ffod2:

Click to download the PDB-style file with coordinates for d1ffod2.
(The format of our PDB-style files is described here.)

Timeline for d1ffod2: