SCOP 1.75: Domain d1ffoa1: 1ffo A:182-274

Lineage for d1ffoa1 (1ffo A:182-274)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
   Uniprot P01901 22-299

8. Domain d1ffoa1: 1ffo A:182-274 [76171]
   Other proteins in same PDB: d1ffoa2, d1ffob_, d1ffod2, d1ffoe_

Details for d1ffoa1

PDB Entry: 1ffo, 2.65 Å

PDB Description: crystal structure of murine class i h-2db complexed with synthetic peptide gp33 (c9m/k1a)

PDB Compounds: (A:) h-2 class I histocompatibility antigen, d-b, alpha chain

SCOP Domain Sequences for d1ffoa1:

Sequence; same for both SEQRES and ATOM records:

>d1ffoa1 b.1.1.2 (A:182-274) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltlrw

Timeline for d1ffoa1:

• d1ffoa1 first appeared in SCOP 1.63
  
• d1ffoa1 appears in SCOP 1.73
  
• d1ffoa1 appears in SCOPe 2.01
  
• d1ffoa1 appears in the current release, SCOPe 2.08