Lineage for d1f6ll_ (1f6l L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220263Species VL domain (kappa) of anti-ferritin antibody (human) [81949] (1 PDB entry)
  8. 220264Domain d1f6ll_: 1f6l L: [76159]

Details for d1f6ll_

PDB Entry: 1f6l (more details), 2.8 Å

PDB Description: variable light chain dimer of anti-ferritin antibody
PDB Compounds: (L:)

SCOP Domain Sequences for d1f6ll_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f6ll_ b.1.1.1 (L:) Immunoglobulin (variable domains of L and H chains) {VL domain (kappa) of anti-ferritin antibody (human)}
diqmtqspaslsasvgetvtitcraseniysylawyqqkqgkspqllvynaktlaegvps
rfsgsgsgtqfslkinslqpedfgsyycqhhygtpftfgsgtklei

SCOP Domain Coordinates for d1f6ll_:

Click to download the PDB-style file with coordinates for d1f6ll_.
(The format of our PDB-style files is described here.)

Timeline for d1f6ll_: