SCOPe 2.01: Domain d1f1gf_: 1f1g F:

Lineage for d1f1gf_ (1f1g F:)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families)
   has additional strand at N-terminus

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [49336] (12 PDB entries)

8. Domain d1f1gf_: 1f1g F: [76158]
   complexed with cu, po4, zn

Details for d1f1gf_

PDB Entry: 1f1g, 1.35 Å

PDB Description: crystal structure of yeast cuznsod exposed to nitric oxide

PDB Compounds: (F:) copper-zinc superoxide dismutase

SCOPe Domain Sequences for d1f1gf_:

Sequence; same for both SEQRES and ATOM records:

>d1f1gf_ b.1.8.1 (F:) Cu,Zn superoxide dismutase, SOD {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
vqavavlkgdagvsgvvkfeqasesepttvsyeiagnspnaergfhihefgdatngcvsa
gphfnpfkkthgaptdevrhvgdmgnvktdengvakgsfkdslikligptsvvgrsvvih
agqddlgkgdteeslktgnagprpacgvigltn

Timeline for d1f1gf_:

• d1f1gf_ first appeared in SCOP 1.63
  
• d1f1gf_ appears in SCOP 1.75
  
• d1f1gf_ appears in SCOPe 2.02
  
• d1f1gf_ appears in the current release, SCOPe 2.08