Class c: Alpha and beta proteins (a/b) [51349] (134 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (32 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.6: PLP-binding barrel [51419] (2 families) circular permutation of the canonical fold: begins with an alpha helix and ends with a beta-strand |
Family c.1.6.1: Alanine racemase-like, N-terminal domain [51420] (3 proteins) |
Protein Alanine racemase [51421] (3 species) |
Species Bacillus stearothermophilus [TaxId:1422] [51422] (8 PDB entries) |
Domain d1epva2: 1epv A:12-244 [76147] Other proteins in same PDB: d1epva1, d1epvb1 |
PDB Entry: 1epv (more details), 2.2 Å
SCOP Domain Sequences for d1epva2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1epva2 c.1.6.1 (A:12-244) Alanine racemase {Bacillus stearothermophilus} vdldaiydnvenlrrllpddthimavvkanayghgdvqvartaleagasrlavafldeal alrekgieapilvlgasrpadaalaaqqrialtvfrsdwleeasalysgpfpihfhlkmd tgmgrlgvkdeeetkrivalierhphfvleglythfatadevntdyfsyqytrflhmlew lpsrpplvhcansaaslrfpdrtfnmvrfgiamyglapspgikpllpyplkea
Timeline for d1epva2: