Lineage for d9icwa3 (9icw A:92-148)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 356779Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 357148Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 357149Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 357150Protein DNA polymerase beta [81579] (2 species)
  7. 357151Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 357155Domain d9icwa3: 9icw A:92-148 [76129]
    Other proteins in same PDB: d9icwa1, d9icwa4
    protein/DNA complex; complexed with na, so4

Details for d9icwa3

PDB Entry: 9icw (more details), 2.6 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; native structure

SCOP Domain Sequences for d9icwa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icwa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d9icwa3:

Click to download the PDB-style file with coordinates for d9icwa3.
(The format of our PDB-style files is described here.)

Timeline for d9icwa3: