Class a: All alpha proteins [46456] (226 folds) |
Fold a.60: SAM domain-like [47768] (14 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) contains one classic and one pseudo HhH motifs |
Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins) topological similarity to the N-terminal domain |
Protein DNA polymerase beta [81579] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81575] (94 PDB entries) |
Domain d9icsa3: 9ics A:92-148 [76121] Other proteins in same PDB: d9icsa1, d9icsa4 protein/DNA complex; complexed with dct, mn, na |
PDB Entry: 9ics (more details), 2.9 Å
SCOP Domain Sequences for d9icsa3:
Sequence; same for both SEQRES and ATOM records: (download)
>d9icsa3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)} dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek
Timeline for d9icsa3: