Lineage for d9icka4 (9ick A:149-335)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 422922Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 422923Superfamily d.218.1: Nucleotidyltransferase [81301] (8 families) (S)
  5. 422931Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 422932Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 422933Species Human (Homo sapiens) [TaxId:9606] [81574] (92 PDB entries)
  8. 422936Domain d9icka4: 9ick A:149-335 [76106]
    Other proteins in same PDB: d9icka1, d9icka3
    protein/DNA complex; complexed with na

Details for d9icka4

PDB Entry: 9ick (more details), 2.7 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of artificial mother liquor

SCOP Domain Sequences for d9icka4:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icka4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d9icka4:

Click to download the PDB-style file with coordinates for d9icka4.
(The format of our PDB-style files is described here.)

Timeline for d9icka4: