Lineage for d9icca4 (9icc A:149-335)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 616179Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 616180Superfamily d.218.1: Nucleotidyltransferase [81301] (9 families) (S)
  5. 616188Family d.218.1.2: DNA polymerase beta-like [81300] (4 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 616189Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 616190Species Human (Homo sapiens) [TaxId:9606] [81574] (94 PDB entries)
  8. 616252Domain d9icca4: 9icc A:149-335 [76092]
    Other proteins in same PDB: d9icca1, d9icca3
    protein/DNA complex; complexed with cr, dtp, na

Details for d9icca4

PDB Entry: 9icc (more details), 3.1 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex + 2'-deoxyadenosine-5'-triphosphate, soaked in the presence of datp and crcl3

SCOP Domain Sequences for d9icca4:

Sequence; same for both SEQRES and ATOM records: (download)

>d9icca4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)}
ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp
kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr
epkdrse

SCOP Domain Coordinates for d9icca4:

Click to download the PDB-style file with coordinates for d9icca4.
(The format of our PDB-style files is described here.)

Timeline for d9icca4: