SCOP 1.67: Domain d8icua3: 8icu A:92-148

Lineage for d8icua3 (8icu A:92-148)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)

8. Domain d8icua3: 8icu A:92-148 [76074]
   Other proteins in same PDB: d8icua1, d8icua4
   protein/DNA complex; complexed with dad, mn, na

Details for d8icua3

PDB Entry: 8icu, 3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of ddatp (1 millimolar) and mncl2 (5 millimolar)

SCOP Domain Sequences for d8icua3:

Sequence; same for both SEQRES and ATOM records:

>d8icua3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d8icua3:

• d8icua3 first appeared in SCOP 1.63
  
• d8icua3 appears in SCOP 1.65
  
• d8icua3 appears in SCOP 1.69
  
• d8icua3 appears in the current release, SCOPe 2.08