SCOP 1.69: Domain d8icha3: 8ich A:92-148

Lineage for d8icha3 (8ich A:92-148)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)

8. Domain d8icha3: 8ich A:92-148 [76048]
   Other proteins in same PDB: d8icha1, d8icha4

Details for d8icha3

PDB Entry: 8ich, 3.3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of dctp (1 millimolar) and mgcl2 (5 millimolar)

SCOP Domain Sequences for d8icha3:

Sequence; same for both SEQRES and ATOM records:

>d8icha3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

Timeline for d8icha3:

• d8icha3 first appeared in SCOP 1.63
  
• d8icha3 appears in SCOP 1.67
  
• d8icha3 appears in SCOP 1.71
  
• d8icha3 appears in the current release, SCOPe 2.08