Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.218: Nucleotidyltransferase [81302] (1 superfamily) core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123 |
Superfamily d.218.1: Nucleotidyltransferase [81301] (4 families) |
Family d.218.1.2: DNA polymerase beta-like [81300] (3 proteins) insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain |
Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [81574] (92 PDB entries) |
Domain d8icea4: 8ice A:149-335 [76043] Other proteins in same PDB: d8icea1, d8icea3 protein/DNA complex; complexed with cd, dtp, na |
PDB Entry: 8ice (more details), 3.2 Å
SCOP Domain Sequences for d8icea4:
Sequence; same for both SEQRES and ATOM records: (download)
>d8icea4 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Human (Homo sapiens)} ripreemlqmqdivlnevkkvdseyiatvcgsfrrgaessgdmdvllthpsftsestkqp kllhqvveqlqkvhfitdtlskgetkfmgvcqlpskndekeyphrridirlipkdqyycg vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdsekdifdyiqwkyr epkdrse
Timeline for d8icea4: