Lineage for d8icba3 (8icb A:92-148)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282595Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 282596Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 282597Protein DNA polymerase beta [81579] (2 species)
  7. 282598Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 282643Domain d8icba3: 8icb A:92-148 [76038]
    Other proteins in same PDB: d8icba1, d8icba4
    protein/DNA complex; complexed with na

Details for d8icba3

PDB Entry: 8icb (more details), 3.1 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of artificial mother liquor

SCOP Domain Sequences for d8icba3:

Sequence; same for both SEQRES and ATOM records: (download)

>d8icba3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d8icba3:

Click to download the PDB-style file with coordinates for d8icba3.
(The format of our PDB-style files is described here.)

Timeline for d8icba3: