Lineage for d7icja3 (7icj A:92-148)

  1. Root: SCOP 1.63
  2. 208553Class a: All alpha proteins [46456] (171 folds)
  3. 214550Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 214859Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 214860Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 214861Protein DNA polymerase beta [81579] (2 species)
  7. 214862Species Human (Homo sapiens) [TaxId:9606] [81575] (92 PDB entries)
  8. 214949Domain d7icja3: 7icj A:92-148 [76010]
    Other proteins in same PDB: d7icja1, d7icja4
    protein/DNA complex; complexed with cu, na

Details for d7icja3

PDB Entry: 7icj (more details), 3.5 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with six base pairs of dna; soaked in the presence of cucl2 (0.1 millimolar)

SCOP Domain Sequences for d7icja3:

Sequence; same for both SEQRES and ATOM records: (download)

>d7icja3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens)}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d7icja3:

Click to download the PDB-style file with coordinates for d7icja3.
(The format of our PDB-style files is described here.)

Timeline for d7icja3: