Lineage for d3bccc2 (3bcc C:262-380)

  1. Root: SCOPe 2.03
  2. 1454900Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1458186Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1458187Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) (S)
  5. 1458188Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins)
    a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 1458189Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species)
  7. 1458201Species Chicken (Gallus gallus) [TaxId:9031] [81644] (8 PDB entries)
  8. 1458214Domain d3bccc2: 3bcc C:262-380 [75998]
    Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_
    complexed with amy, fes, hem, sig

Details for d3bccc2

PDB Entry: 3bcc (more details), 3.7 Å

PDB Description: stigmatellin and antimycin bound cytochrome bc1 complex from chicken
PDB Compounds: (C:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d3bccc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bccc2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3bccc2:

Click to download the PDB-style file with coordinates for d3bccc2.
(The format of our PDB-style files is described here.)

Timeline for d3bccc2: