![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily) core: three transmembrane helices, up-and-down bundle |
![]() | Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (1 family) ![]() |
![]() | Family f.32.1.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81647] (2 proteins) a part (domain) of mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, C-terminal domain [81646] (3 species) |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [81644] (3 PDB entries) |
![]() | Domain d3bccc2: 3bcc C:262-380 [75998] Other proteins in same PDB: d3bcca1, d3bcca2, d3bccb1, d3bccb2, d3bccc3, d3bccd2, d3bccd3, d3bcce1, d3bcce2, d3bccf_, d3bccg_, d3bcch_, d3bccj_ |
PDB Entry: 3bcc (more details), 3.7 Å
SCOP Domain Sequences for d3bccc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bccc2 f.32.1.1 (C:262-380) Mitochondrial cytochrome b subunit, C-terminal domain {Chicken (Gallus gallus)} plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny
Timeline for d3bccc2: