Lineage for d2hgsa4 (2hgs A:3-201,A:304-474)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 334707Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 334708Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (6 families) (S)
  5. 334879Family d.142.1.6: Eukaryotic glutathione synthetase ATP-binding domain [56088] (1 protein)
    circularly permuted version of prokaryotic enzyme
  6. 334880Protein Eukaryotic glutathione synthetase ATP-binding domain [56089] (2 species)
  7. 334886Species Human (Homo sapiens) [TaxId:9606] [56090] (1 PDB entry)
  8. 334887Domain d2hgsa4: 2hgs A:3-201,A:304-474 [75997]
    Other proteins in same PDB: d2hgsa1
    complexed with adp, gsh, mg, sul

Details for d2hgsa4

PDB Entry: 2hgs (more details), 2.1 Å

PDB Description: human glutathione synthetase

SCOP Domain Sequences for d2hgsa4:

Sequence; same for both SEQRES and ATOM records: (download)

>d2hgsa4 d.142.1.6 (A:3-201,A:304-474) Eukaryotic glutathione synthetase ATP-binding domain {Human (Homo sapiens)}
tnwgsllqdkqqleelarqavdralaegvllrtsqeptssevvsyapftlfpslvpsall
eqayavqmdfnllvdavsqnaafleqtlsstikqddftarlfdihkqvlkegiaqtvflg
lnrsdymfqrsadgspalkqieintisasfgglasrtpavhrhvlsvlsktkeagkilsn
npskglalgiakawelygsXtkkvqqelsrpgmlemllpgqpeavarlratfaglysldv
geegdqaiaealaapsrfvlkpqregggnnlygeemvqalkqlkdseerasyilmekiep
epfencllrpgsparvvqciselgifgvyvrqektlvmnkhvghllrtkaiehadggvaa
gvavldnpypv

SCOP Domain Coordinates for d2hgsa4:

Click to download the PDB-style file with coordinates for d2hgsa4.
(The format of our PDB-style files is described here.)

Timeline for d2hgsa4:

View in 3D
Domains from same chain:
(mouse over for more information)
d2hgsa1