SCOP 1.75: Domain d2bpca1: 2bpc A:91-148

Lineage for d2bpca1 (2bpc A:91-148)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (18 PDB entries)

8. Domain d2bpca1: 2bpc A:91-148 [75989]
   Other proteins in same PDB: d2bpca2
   complexed with mn

Details for d2bpca1

PDB Entry: 2bpc, 2.8 Å

PDB Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism

PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d2bpca1:

Sequence; same for both SEQRES and ATOM records:

>d2bpca1 a.60.12.1 (A:91-148) DNA polymerase beta {Rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d2bpca1:

• d2bpca1 first appeared in SCOP 1.63, called d2bpc_1
  
• d2bpca1 appears in SCOP 1.73
  
• d2bpca1 appears in SCOPe 2.01
  
• d2bpca1 appears in the current release, SCOPe 2.08