SCOP 1.69: Domain d2bpc_1: 2bpc 91-148

Lineage for d2bpc_1 (2bpc 91-148)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.60: SAM domain-like [47768] (13 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)

8. Domain d2bpc_1: 2bpc 91-148 [75989]
   Other proteins in same PDB: d2bpc_2

Details for d2bpc_1

PDB Entry: 2bpc, 2.8 Å

PDB Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism

SCOP Domain Sequences for d2bpc_1:

Sequence; same for both SEQRES and ATOM records:

>d2bpc_1 a.60.12.1 (91-148) DNA polymerase beta {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d2bpc_1:

• d2bpc_1 first appeared in SCOP 1.63
  
• d2bpc_1 appears in SCOP 1.67
  
• d2bpc_1 appears in SCOP 1.71
  
• d2bpc_1 appears in the current release, SCOPe 2.08, called d2bpca1