Lineage for d2bpc_1 (2bpc 91-148)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 282277Fold a.60: SAM domain-like [47768] (13 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 282595Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 282596Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (2 proteins)
    topological similarity to the N-terminal domain
  6. 282597Protein DNA polymerase beta [81579] (2 species)
  7. 282691Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)
  8. 282704Domain d2bpc_1: 2bpc 91-148 [75989]
    Other proteins in same PDB: d2bpc_2
    complexed with mn

Details for d2bpc_1

PDB Entry: 2bpc (more details), 2.8 Å

PDB Description: crystal structure of rat dna polymerase beta: evidence for a common polymerase mechanism

SCOP Domain Sequences for d2bpc_1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpc_1 a.60.12.1 (91-148) DNA polymerase beta {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

SCOP Domain Coordinates for d2bpc_1:

Click to download the PDB-style file with coordinates for d2bpc_1.
(The format of our PDB-style files is described here.)

Timeline for d2bpc_1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bpc_2