SCOP 1.71: Domain d1zqx_1: 1zqx 91-148

Lineage for d1zqx_1 (1zqx 91-148)

1. Root: SCOP 1.71

2. Class a: All alpha proteins [46456] (226 folds)

3. Fold a.60: SAM domain-like [47768] (14 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (17 PDB entries)

8. Domain d1zqx_1: 1zqx 91-148 [75981]
   Other proteins in same PDB: d1zqx_2

Details for d1zqx_1

PDB Entry: 1zqx, 2.5 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of kcl (150 millimolar)

SCOP Domain Sequences for d1zqx_1:

Sequence; same for both SEQRES and ATOM records:

>d1zqx_1 a.60.12.1 (91-148) DNA polymerase beta {Rat (Rattus norvegicus)}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1zqx_1:

• d1zqx_1 first appeared in SCOP 1.63
  
• d1zqx_1 appears in SCOP 1.69
  
• d1zqx_1 is called d1zqxa1 in SCOP 1.73
  
• d1zqx_1 appears in the current release, SCOPe 2.08, called d1zqxa1