SCOPe 2.08: Domain d1zqwa1: 1zqw A:91-148

Lineage for d1zqwa1 (1zqw A:91-148)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.60: SAM domain-like [47768] (17 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (3 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain
   automatically mapped to Pfam PF10391

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [81577] (23 PDB entries)

8. Domain d1zqwa1: 1zqw A:91-148 [75979]
   Other proteins in same PDB: d1zqwa2

Details for d1zqwa1

PDB Entry: 1zqw, 2.3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of cscl (150 millimolar)

PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1zqwa1:

Sequence; same for both SEQRES and ATOM records:

>d1zqwa1 a.60.12.1 (A:91-148) DNA polymerase beta {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1zqwa1:

• d1zqwa1 first appeared in SCOP 1.63, called d1zqw_1
  
• d1zqwa1 appears in SCOPe 2.07