SCOP 1.75: Domain d1zqua1: 1zqu A:91-148

Lineage for d1zqua1 (1zqu A:91-148)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.60: SAM domain-like [47768] (16 superfamilies)
   4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins

4. Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families)
   contains one classic and one pseudo HhH motifs

5. Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
   topological similarity to the N-terminal domain

6. Protein DNA polymerase beta [81579] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [81577] (18 PDB entries)

8. Domain d1zqua1: 1zqu A:91-148 [75975]
   Other proteins in same PDB: d1zqua2

Details for d1zqua1

PDB Entry: 1zqu, 2.6 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of artificial mother liquor

PDB Compounds: (A:) DNA polymerase beta

SCOP Domain Sequences for d1zqua1:

Sequence; same for both SEQRES and ATOM records:

>d1zqua1 a.60.12.1 (A:91-148) DNA polymerase beta {Rat (Rattus norvegicus) [TaxId: 10116]}
ddtsssinfltrvtgigpsaarklvdegiktledlrknedklnhhqriglkyfedfek

Timeline for d1zqua1:

• d1zqua1 first appeared in SCOP 1.63, called d1zqu_1
  
• d1zqua1 appears in SCOP 1.73
  
• d1zqua1 appears in SCOPe 2.01
  
• d1zqua1 appears in the current release, SCOPe 2.08