Lineage for d1zqra3 (1zqr A:92-148)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1272161Fold a.60: SAM domain-like [47768] (16 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 1272870Superfamily a.60.12: PsbU/PolX domain-like [81585] (2 families) (S)
    contains one classic and one pseudo HhH motifs
  5. 1272871Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
    automatically mapped to Pfam PF10391
  6. 1272872Protein DNA polymerase beta [81579] (2 species)
  7. 1272873Species Human (Homo sapiens) [TaxId:9606] [81575] (132 PDB entries)
  8. 1273002Domain d1zqra3: 1zqr A:92-148 [75969]
    Other proteins in same PDB: d1zqra1, d1zqra4
    protein/DNA complex; complexed with na, ni

Details for d1zqra3

PDB Entry: 1zqr (more details), 3.7 Å

PDB Description: dna polymerase beta (e.c.2.7.7.7)/dna complex, soaked in the presence of nicl2
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOPe Domain Sequences for d1zqra3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqra3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOPe Domain Coordinates for d1zqra3:

Click to download the PDB-style file with coordinates for d1zqra3.
(The format of our PDB-style files is described here.)

Timeline for d1zqra3: