Lineage for d1zqha3 (1zqh A:92-148)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 642790Fold a.60: SAM domain-like [47768] (15 superfamilies)
    4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins
  4. 643336Superfamily a.60.12: DNA polymerase beta-like, second domain [81585] (1 family) (S)
    contains one classic and one pseudo HhH motifs
  5. 643337Family a.60.12.1: DNA polymerase beta-like, second domain [81584] (3 proteins)
    topological similarity to the N-terminal domain
  6. 643338Protein DNA polymerase beta [81579] (2 species)
  7. 643339Species Human (Homo sapiens) [TaxId:9606] [81575] (103 PDB entries)
  8. 643442Domain d1zqha3: 1zqh A:92-148 [75949]
    Other proteins in same PDB: d1zqha1, d1zqha4
    protein/DNA complex; complexed with na

Details for d1zqha3

PDB Entry: 1zqh (more details), 3.1 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7) complexed with seven base pairs of dna; soaked in the presence of a sodium-free artificial mother liquor at ph 7.5
PDB Compounds: (A:) protein (DNA polymerase beta (e.c.2.7.7.7))

SCOP Domain Sequences for d1zqha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zqha3 a.60.12.1 (A:92-148) DNA polymerase beta {Human (Homo sapiens) [TaxId: 9606]}
dtsssinfltrvsgigpsaarkfvdegiktledlrknedklnhhqriglkyfgdfek

SCOP Domain Coordinates for d1zqha3:

Click to download the PDB-style file with coordinates for d1zqha3.
(The format of our PDB-style files is described here.)

Timeline for d1zqha3: