Lineage for d1qcrc3 (1qcr C:2-260)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2253332Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
    core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices
  4. 2253333Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) (S)
    Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically
  5. 2253339Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
    a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria
  6. 2253350Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species)
    also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits
  7. 2253372Species Cow (Bos taurus) [TaxId:9913] [81638] (18 PDB entries)
    Uniprot P00157
  8. 2253394Domain d1qcrc3: 1qcr C:2-260 [75932]
    Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_
    complexed with hem

Details for d1qcrc3

PDB Entry: 1qcr (more details), 2.7 Å

PDB Description: crystal structure of bovine mitochondrial cytochrome bc1 complex, alpha carbon atoms only
PDB Compounds: (C:) ubiquinol cytochrome c oxidoreductase

SCOPe Domain Sequences for d1qcrc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qcrc3 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]}
tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt
afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll
tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf
hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml
lvlfapdllgdpdnytpan

SCOPe Domain Coordinates for d1qcrc3:

Click to download the PDB-style file with coordinates for d1qcrc3.
(The format of our PDB-style files is described here.)

Timeline for d1qcrc3: