![]() | Class f: Membrane and cell surface proteins and peptides [56835] (47 folds) |
![]() | Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies) core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices |
![]() | Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families) ![]() Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically |
![]() | Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (2 proteins) a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria |
![]() | Protein Mitochondrial cytochrome b subunit, N-terminal domain [81641] (3 species) also includes extra transmembrane (linker) helix absent in plants and cyanobacteria subunits |
![]() | Species Cow (Bos taurus) [TaxId:9913] [81638] (12 PDB entries) |
![]() | Domain d1qcrc3: 1qcr C:2-260 [75932] Other proteins in same PDB: d1qcra1, d1qcra2, d1qcrb1, d1qcrb2, d1qcrc2, d1qcrd2, d1qcrd3, d1qcre1, d1qcre2, d1qcrf_, d1qcrg_, d1qcrh_, d1qcrj_, d1qcrk_ |
PDB Entry: 1qcr (more details), 2.7 Å
SCOP Domain Sequences for d1qcrc3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qcrc3 f.21.1.2 (C:2-260) Mitochondrial cytochrome b subunit, N-terminal domain {Cow (Bos taurus)} tnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdttt afssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvilll tvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffaf hfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalml lvlfapdllgdpdnytpan
Timeline for d1qcrc3: