Lineage for d1noma2 (1nom A:149-335)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2239280Fold d.218: Nucleotidyltransferase [81302] (1 superfamily)
    core: alpha-beta-turn-beta-X-beta-(alpha); mixed beta-sheet, order of core strands: 123
  4. 2239281Superfamily d.218.1: Nucleotidyltransferase [81301] (16 families) (S)
  5. 2239289Family d.218.1.2: DNA polymerase beta-like [81300] (5 proteins)
    insert X in the core is an alpha-beta(2) unit; mixed 5-stranded sheet, order: 12543; contains extra C-terminal alpha+beta subdomain
  6. 2239290Protein DNA polymerase beta, catalytic (31 kD) fragment [81578] (2 species)
  7. 2239437Species Norway rat (Rattus norvegicus) [TaxId:10116] [81576] (23 PDB entries)
  8. 2239457Domain d1noma2: 1nom A:149-335 [75930]
    Other proteins in same PDB: d1noma1
    complexed with mn

Details for d1noma2

PDB Entry: 1nom (more details), 3 Å

PDB Description: dna polymerase beta (pol b) (e.c.2.7.7.7), 31-kd domain; soaked in the presence of mncl2 (5 millimolar)
PDB Compounds: (A:) DNA polymerase beta

SCOPe Domain Sequences for d1noma2:

Sequence, based on SEQRES records: (download)

>d1noma2 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpsendeneyphrridirlipkdqyycg
vlyftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryr
epkdrse

Sequence, based on observed residues (ATOM records): (download)

>d1noma2 d.218.1.2 (A:149-335) DNA polymerase beta, catalytic (31 kD) fragment {Norway rat (Rattus norvegicus) [TaxId: 10116]}
ripreemlqmqdivlnevkkldpeyiatvcgsfrrgaessgdmdvllthpnftsesskqp
kllhrvveqlqkvrfitdtlskgetkfmgvcqlpseneyphrridirlipkdqyycgvly
ftgsdifnknmrahalekgftineytirplgvtgvageplpvdseqdifdyiqwryrepk
drse

SCOPe Domain Coordinates for d1noma2:

Click to download the PDB-style file with coordinates for d1noma2.
(The format of our PDB-style files is described here.)

Timeline for d1noma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1noma1